Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoprotein lipase
LigandBDBM50254396
Substrate/Competitorn/a
Meas. Tech.ChEMBL_559993
IC50 16000±n/a nM
Citation Goodman KBBury MJCheung MCichy-Knight MADowdell SEDunn AKLee DLieby JAMoore MLScherzer DASha DSuarez DPMurphy DJHarpel MRManas ESMcNulty DEAnnan RSMatico RESchwartz BKTrill JJSweitzer TDWang DYKeller PMKrawiec JAJaye MC Discovery of potent, selective sulfonylfuran urea endothelial lipase inhibitors. Bioorg Med Chem Lett 19:27-30 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lipoprotein lipase
Name:Lipoprotein lipase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53093.31
Organism:Rattus norvegicus
Description:ChEMBL_559993
Residue:474
Sequence:
MESKALLLVALGVWLQSLTAFRGGVAAADGGRDFSDIESKFALRTPEDTAEDTCHLIPGL
ADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQH
YPVSAGYTKLVGNDVARFINWLEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAEKGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTENDKQNNQ
AFEISLYGTVAESENIPFTLPEVATNKTYSFLIYTEVDIGELLMMKLKWKNDSYFRWSDW
WSSPSFVIEKIRVKAGETQKKVIFCAREKVSHLQKGKDAAVFVKCHDKSLKKSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50254396
n/a
NameBDBM50254396
Synonyms:1-methyl-1-(2-methyl-5-(piperidin-1-ylsulfonyl)furan-3-yl)-3-phenylurea | CHEMBL512119
TypeSmall organic molecule
Emp. Form.C18H23N3O4S
Mol. Mass.377.458
SMILESCN(C(=O)Nc1ccccc1)c1cc(oc1C)S(=O)(=O)N1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: