| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50266060 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_540202 (CHEMBL1029831) |
|---|
| Ki | 3.35±n/a nM |
|---|
| Citation |  Ballet, S; Feytens, D; Wachter, RD; Vlaeminck, MD; Marczak, ED; Salvadori, S; Graaf, C; Rognan, D; Negri, L; Lattanzi, R; Lazarus, LH; Tourwé, D; Balboni, G Conformationally constrained opioid ligands: the Dmt-Aba and Dmt-Aia versus Dmt-Tic scaffold. Bioorg Med Chem Lett19:433-7 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50266060 |
|---|
| n/a |
|---|
| Name | BDBM50266060 |
|---|
| Synonyms: | (S)-2-amino-N-((R)-2-(2-(benzylamino)-2-oxoethyl)-3-oxo-1,2,3,4,5,10-hexahydroazepino[3,4-b]indol-4-yl)-3-(4-hydroxy-2,6-dimethylphenyl)propanamide | CHEMBL506761 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H35N5O4 |
|---|
| Mol. Mass. | 553.6514 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N[C@@H]1Cc2c(CN(CC(=O)NCc3ccccc3)C1=O)[nH]c1ccccc21 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
