| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50254013 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_560535 (CHEMBL1021385) |
|---|
| Ki | 1005±n/a nM |
|---|
| Citation |  Gillespie, RJ; Bamford, SJ; Botting, R; Comer, M; Denny, S; Gaur, S; Griffin, M; Jordan, AM; Knight, AR; Lerpiniere, J; Leonardi, S; Lightowler, S; McAteer, S; Merrett, A; Misra, A; Padfield, A; Reece, M; Saadi, M; Selwood, DL; Stratton, GC; Surry, D; Todd, R; Tong, X; Ruston, V; Upton, R; Weiss, SM Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines. J Med Chem52:33-47 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50254013 |
|---|
| n/a |
|---|
| Name | BDBM50254013 |
|---|
| Synonyms: | 3-(4-Amino-3-methylbenzyl)-7-(2-furyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine-5-amine | CHEMBL447664 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H15N7O |
|---|
| Mol. Mass. | 321.3366 |
|---|
| SMILES | Cc1cc(Cn2nnc3c(nc(N)nc23)-c2ccco2)ccc1N |
|---|
| Structure | 
|
|---|
Search and Browse
