| Reaction Details |
|---|
 | Report a problem with these data |
| Target | D(3) dopamine receptor |
|---|
| Ligand | BDBM50131930 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_558362 (CHEMBL954164) |
|---|
| Ki | 0.38±n/a nM |
|---|
| Citation |  Butini, S; Gemma, S; Campiani, G; Franceschini, S; Trotta, F; Borriello, M; Ceres, N; Ros, S; Coccone, SS; Bernetti, M; De Angelis, M; Brindisi, M; Nacci, V; Fiorini, I; Novellino, E; Cagnotto, A; Mennini, T; Sandager-Nielsen, K; Andreasen, JT; Scheel-Kruger, J; Mikkelsen, JD; Fattorusso, C Discovery of a new class of potential multifunctional atypical antipsychotic agents targeting dopamine D3 and serotonin 5-HT1A and 5-HT2A receptors: design, synthesis, and effects on behavior. J Med Chem52:151-69 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| D(3) dopamine receptor |
|---|
| Name: | D(3) dopamine receptor |
|---|
| Synonyms: | DOPAMINE D3 | DRD3 | DRD3_HUMAN | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 44243.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 400 |
|---|
| Sequence: | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
|
|
|
|---|
| BDBM50131930 |
|---|
| n/a |
|---|
| Name | BDBM50131930 |
|---|
| Synonyms: | 5-Chloro-1H-indole-2-carboxylic acid {4-[4-(2,4-dichloro-phenyl)-piperazin-1-yl]-butyl}-amide | 5-chloro-N-(4-(4-(2,4-dichlorophenyl)piperazin-1-yl)butyl)-1H-indole-2-carboxamide | CHEMBL126889 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H25Cl3N4O |
|---|
| Mol. Mass. | 479.83 |
|---|
| SMILES | Clc1ccc(N2CCN(CCCCNC(=O)c3cc4cc(Cl)ccc4[nH]3)CC2)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
