Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1A |
---|
Ligand | BDBM21398 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_558363 (CHEMBL954165) |
---|
Ki | 1800±n/a nM |
---|
Citation | Butini, S; Gemma, S; Campiani, G; Franceschini, S; Trotta, F; Borriello, M; Ceres, N; Ros, S; Coccone, SS; Bernetti, M; De Angelis, M; Brindisi, M; Nacci, V; Fiorini, I; Novellino, E; Cagnotto, A; Mennini, T; Sandager-Nielsen, K; Andreasen, JT; Scheel-Kruger, J; Mikkelsen, JD; Fattorusso, C Discovery of a new class of potential multifunctional atypical antipsychotic agents targeting dopamine D3 and serotonin 5-HT1A and 5-HT2A receptors: design, synthesis, and effects on behavior. J Med Chem52:151-69 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1A |
---|
Name: | 5-hydroxytryptamine receptor 1A |
Synonyms: | 5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A (5HT1A) | 5HT1A_RAT | 5ht1a | G-21 | Htr1a | Serotonin 1 (5-HT1) receptor | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46445.29 |
Organism: | Rattus norvegicus (rat) |
Description: | Binding assays were performed using rat hippocampal membranes. |
Residue: | 422 |
Sequence: | MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
|
|
|
BDBM21398 |
---|
n/a |
---|
Name | BDBM21398 |
Synonyms: | 4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl) | 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL54 | CHEMBL545608 | Haloperidol | Haloperidol, 1 |
Type | Small organic molecule |
Emp. Form. | C21H23ClFNO2 |
Mol. Mass. | 375.864 |
SMILES | OC1(CCN(CCCC(=O)c2ccc(F)cc2)CC1)c1ccc(Cl)cc1 |
Structure |
|