| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50096001 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_558850 (CHEMBL1021636) |
|---|
| Ki | 500±n/a nM |
|---|
| Citation |  Cournia, Z; Leng, L; Gandavadi, S; Du, X; Bucala, R; Jorgensen, WL Discovery of human macrophage migration inhibitory factor (MIF)-CD74 antagonists via virtual screening. J Med Chem52:416-24 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50096001 |
|---|
| n/a |
|---|
| Name | BDBM50096001 |
|---|
| Synonyms: | 7-Hydroxy-3-pyrazolo[1,5-a]pyridin-2-yl-chromen-2-one | 7-hydroxy-3-(pyrazolo[1,5-a]pyridin-2-yl)-2H-chromen-2-one | CHEMBL153425 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H10N2O3 |
|---|
| Mol. Mass. | 278.2622 |
|---|
| SMILES | Oc1ccc2cc(-c3cc4ccccn4n3)c(=O)oc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
