Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50277228
Substrate/Competitorn/a
Meas. Tech.ChEMBL_540512
Ki 100±n/a nM
Citation Goodman AJAjello CWWorm KLe Bourdonnec BSavolainen MAO'Hare HCassel JAStabley GJDehaven RNLabuda CJKoblish MLittle PJBrogdon BLSmith SADolle RE CB2 selective sulfamoyl benzamides: optimization of the amide functionality. Bioorg Med Chem Lett 19:309-13 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277228
n/a
NameBDBM50277228
Synonyms:4-(5-(5-tert-butyl-4H-1,2,4-triazol-3-yl)-2-methylphenylsulfonyl)morpholine | CHEMBL473698
TypeSmall organic molecule
Emp. Form.C17H24N4O3S
Mol. Mass.364.462
SMILESCc1ccc(cc1S(=O)(=O)N1CCOCC1)-c1nnc([nH]1)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: