Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50255877 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_515651 (CHEMBL1029743) |
---|
Ki | 0.997000±n/a nM |
---|
Citation | Briard, E; Zoghbi, SS; Siméon, FG; Imaizumi, M; Gourley, JP; Shetty, HU; Lu, S; Fujita, M; Innis, RB; Pike, VW Single-step high-yield radiosynthesis and evaluation of a sensitive 18F-labeled ligand for imaging brain peripheral benzodiazepine receptors with PET. J Med Chem52:688-99 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 18834.74 |
Organism: | Homo sapiens (Human) |
Description: | P30536 |
Residue: | 169 |
Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
BDBM50255877 |
---|
n/a |
---|
Name | BDBM50255877 |
Synonyms: | CHEMBL473435 | N-Fluoroacetyl-N-(2,5-dimethoxybenzyl)-2-phenoxyaniline |
Type | Small organic molecule |
Emp. Form. | C23H22FNO4 |
Mol. Mass. | 395.4235 |
SMILES | COc1ccc(OC)c(CN(C(=O)CF)c2ccccc2Oc2ccccc2)c1 |
Structure |
|