Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50255877
Substrate/Competitorn/a
Meas. Tech.ChEMBL_515649
Ki 0.180000±n/a nM
Citation Briard EZoghbi SSSiméon FGImaizumi MGourley JPShetty HULu SFujita MInnis RBPike VW Single-step high-yield radiosynthesis and evaluation of a sensitive 18F-labeled ligand for imaging brain peripheral benzodiazepine receptors with PET. J Med Chem 52:688-99 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50255877
n/a
NameBDBM50255877
Synonyms:CHEMBL473435 | N-Fluoroacetyl-N-(2,5-dimethoxybenzyl)-2-phenoxyaniline
TypeSmall organic molecule
Emp. Form.C23H22FNO4
Mol. Mass.395.4235
SMILESCOc1ccc(OC)c(CN(C(=O)CF)c2ccccc2Oc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: