Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTGF-beta receptor type I
LigandBDBM50255960
Substrate/Competitorn/a
Meas. Tech.ChEMBL_516219
Ki 0.33±n/a nM
Citation Bonafoux DChuaqui CBoriack-Sjodin PAFitch CHankins GJosiah SBlack CHetu GLing LLee WC 2-Aminoimidazoles inhibitors of TGF-beta receptor 1. Bioorg Med Chem Lett 19:912-6 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TGF-beta receptor type I
Name:TGF-beta receptor type I
Synonyms:2.7.11.30 | ALK-5 | ALK5 | ALK5 | ALK5/TGFBR1 | Activin A receptor type II-like protein kinase of 53kD | Activin receptor-like kinase 5 | Activin receptor-like kinase 5 (ALK-5) | Activin receptor-like kinase 5 (ALK5/TGFbeta) | P36897 | SKR4 | TGF-beta receptor type-1 | TGF-beta receptor type-1 (TGFR1) | TGFBR1 | Transforming Growth Factor
Type:n/a
Mol. Mass.:55968.24
Organism:Homo sapiens (Human)
Description:n/a
Residue:503
Sequence:
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50255960
n/a
NameBDBM50255960
Synonyms:4-(6-methylpyridin-2-yl)-5-(quinoxalin-6-yl)thiazol-2-amine | CHEMBL519948
TypeSmall organic molecule
Emp. Form.C17H13N5S
Mol. Mass.319.384
SMILESCc1cccc(n1)-c1nc(N)sc1-c1ccc2nccnc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: