Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM50277211
Substrate/Competitorn/a
Meas. Tech.ChEMBL_540736
Ki 42.5±n/a nM
Citation Dounay ABBarta NSBikker JABorosky SACampbell BMCrawford TDenny LEvans LMGray DLLee PLenoir EAXu W Synthesis and pharmacological evaluation of aminopyrimidine series of 5-HT1A partial agonists. Bioorg Med Chem Lett 19:1159-63 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277211
n/a
NameBDBM50277211
Synonyms:CHEMBL475090 | N-cyclopropyl-4-(1-(2-(2,3-dihydro-1H-inden-2-yl)ethyl)piperidin-3-yl)pyrimidin-2-amine
TypeSmall organic molecule
Emp. Form.C23H30N4
Mol. Mass.362.5111
SMILESC(CN1CCCC(C1)c1ccnc(NC2CC2)n1)C1Cc2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: