| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50266445 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_517099 (CHEMBL988704) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Béguin, C; Duncan, KK; Munro, TA; Ho, DM; Xu, W; Liu-Chen, LY; Carlezon, WA; Cohen, BM Modification of the furan ring of salvinorin A: identification of a selective partial agonist at the kappa opioid receptor. Bioorg Med Chem17:1370-80 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50266445 |
|---|
| n/a |
|---|
| Name | BDBM50266445 |
|---|
| Synonyms: | (2S,4aR,6aR,7R,9S,10aS,10bR)-2-isopropyl 7-methyl 9-acetoxy-6a,10b-dimethyl-4,10-dioxododecahydro-1H-benzo[f]isochromene-2,7-dicarboxylate | CHEMBL456923 | US8492564, 20 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H32O9 |
|---|
| Mol. Mass. | 452.4948 |
|---|
| SMILES | COC(=O)[C@@H]1C[C@H](OC(C)=O)C(=O)[C@H]2[C@@]1(C)CC[C@H]1C(=O)O[C@@H](C[C@]21C)C(=O)OC(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
