| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50276498 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_540961 (CHEMBL1030681) |
|---|
| IC50 | 3501±n/a nM |
|---|
| Citation |  Dockendorff, C; Jin, S; Olsen, M; Lautens, M; Coupal, M; Hodzic, L; Spear, N; Payza, K; Walpole, C; Tomaszewski, MJ Discovery of mu-opioid selective ligands derived from 1-aminotetralin scaffolds made via metal-catalyzed ring-opening reactions. Bioorg Med Chem Lett19:1228-32 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50276498 |
|---|
| n/a |
|---|
| Name | BDBM50276498 |
|---|
| Synonyms: | (+/-)-3,4-dichloro-N-(2-(dimethylamino)-6,7-dimethoxy-1,2,3,4-tetrahydronaphthalen-1-yl)-N-(2-methoxyethyl)benzamide | CHEMBL461258 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30Cl2N2O4 |
|---|
| Mol. Mass. | 481.412 |
|---|
| SMILES | COCCN(C1C(CCc2cc(OC)c(OC)cc12)N(C)C)C(=O)c1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
