| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 2 |
|---|
| Ligand | BDBM50248456 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_566224 (CHEMBL963305) |
|---|
| Ki | 4±n/a nM |
|---|
| Citation |  Biju, P; Taveras, AG; Dwyer, MP; Yu, Y; Chao, J; Hipkin, RW; Fan, X; Rindgen, D; Fine, J; Lundell, D Fluoroalkyl alpha side chain containing 3,4-diamino-cyclobutenediones as potent and orally bioavailable CXCR2-CXCR1 dual antagonists. Bioorg Med Chem Lett19:1431-3 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 2 |
|---|
| Name: | C-X-C chemokine receptor type 2 |
|---|
| Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40767.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25025 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
|---|
| BDBM50248456 |
|---|
| n/a |
|---|
| Name | BDBM50248456 |
|---|
| Synonyms: | (S)-3-(3,4-dioxo-2-(2,2,3,3,3-pentafluoro-1-(5-methylfuran-2-yl)propylamino)cyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL523645 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H18F5N3O5 |
|---|
| Mol. Mass. | 487.3767 |
|---|
| SMILES | CN(C)C(=O)c1cccc(Nc2c(N[C@@H](c3ccc(C)o3)C(F)(F)C(F)(F)F)c(=O)c2=O)c1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
