Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-1 Nicotinic AChR
LigandBDBM50413331
Substrate/Competitorn/a
Meas. Tech.ChEMBL_566266
IC50 100000±n/a nM
Citation Enz AFeuerbach DFrederiksen MUGentsch CHurth KMüller WNozulak JRoy BL Gamma-lactams--a novel scaffold for highly potent and selective alpha 7 nicotinic acetylcholine receptor agonists. Bioorg Med Chem Lett 19:1287-91 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
alpha-1 Nicotinic AChR
Name:Nicotinic acetylcholine receptor alpha-1/beta-1/delta/epsilon
Synonyms:Acetylcholine receptor protein alpha chain | Acetylcholine receptor subunit alpha | Cholinergic, Nicotinic Alpha1Beta1DeltaGamma | Cholinergic, Nicotinic Alpha1Beta2 | Nicotinic acetylcholine receptor alpha2/beta4 | n-AChR
Type:Ion channel
Mol. Mass.:54542.01
Organism:Homo sapiens (Human)
Description:n/a
Residue:482
Sequence:
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50413331
n/a
NameBDBM50413331
Synonyms:CHEMBL459900
TypeSmall organic molecule
Emp. Form.C21H24N2O2
Mol. Mass.336.4275
SMILESCN1C(CC(CN2CCCCC2)C1=O)C#Cc1ccc2occc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: