Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, heart |
---|
Ligand | BDBM50247995 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_566943 (CHEMBL964126) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Barf, T; Lehmann, F; Hammer, K; Haile, S; Axen, E; Medina, C; Uppenberg, J; Svensson, S; Rondahl, L; Lundbäck, T N-Benzyl-indolo carboxylic acids: Design and synthesis of potent and selective adipocyte fatty-acid binding protein (A-FABP) inhibitors. Bioorg Med Chem Lett19:1745-8 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, heart |
---|
Name: | Fatty acid-binding protein, heart |
Synonyms: | FABP11 | FABP3 | FABPH_HUMAN | Fatty acid binding protein muscle | MDGI |
Type: | PROTEIN |
Mol. Mass.: | 14858.36 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1463784 |
Residue: | 133 |
Sequence: | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
|
|
|
BDBM50247995 |
---|
n/a |
---|
Name | BDBM50247995 |
Synonyms: | 5-(4-fluorobenzyl)-5,6,7,8,9,10-hexahydrocyclohepta[b]indole-4-carboxylic acid | CHEMBL518181 |
Type | Small organic molecule |
Emp. Form. | C21H20FNO2 |
Mol. Mass. | 337.3874 |
SMILES | OC(=O)c1cccc2c3CCCCCc3n(Cc3ccc(F)cc3)c12 |
Structure |
|