| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50257493 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_566709 (CHEMBL961701) |
|---|
| Ki | 12±n/a nM |
|---|
| Citation |  Holl, R; Schepmann, D; Fröhlich, R; Grünert, R; Bednarski, PJ; Wünsch, B Dancing of the second aromatic residue around the 6,8-diazabicyclo[3.2.2]nonane framework: influence on sigma receptor affinity and cytotoxicity. J Med Chem52:2126-37 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50257493 |
|---|
| n/a |
|---|
| Name | BDBM50257493 |
|---|
| Synonyms: | (R)-(1-benzyl-4-(4-methoxybenzyl)piperazin-2-yl)methanol | CHEMBL502377 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H26N2O2 |
|---|
| Mol. Mass. | 326.4326 |
|---|
| SMILES | COc1ccc(CN2CCN(Cc3ccccc3)[C@@H](CO)C2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
