Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin releasing hormone 1 (GnRHR1)
LigandBDBM50256884
Substrate/Competitorn/a
Meas. Tech.ChEMBL_562460
IC50 24±n/a nM
Citation Pelletier JCChengalvala MVCottom JEFeingold IBGreen DMHauze DBHuselton CAJetter JWKopf GSLundquist JTMagolda RLMann CWMehlmann JFRogers JFShanno LKAdams WRTio COWrobel JE Discovery of 6-({4-[2-(4-tert-butylphenyl)-1H-benzimidazol-4-yl]piperazin-1-yl}methyl)quinoxaline (WAY-207024): an orally active antagonist of the gonadotropin releasing hormone receptor (GnRH-R). J Med Chem 52:2148-52 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin releasing hormone 1 (GnRHR1)
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH)
Type:Enzyme
Mol. Mass.:37749.45
Organism:Homo sapiens (Human)
Description:P30968
Residue:328
Sequence:
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50256884
n/a
NameBDBM50256884
Synonyms:7-((4-(2-(4-tert-butylphenyl)-1H-benzo[d]imidazol-4-yl)piperazin-1-yl)methyl)quinoline | CHEMBL475660
TypeSmall organic molecule
Emp. Form.C31H33N5
Mol. Mass.475.6272
SMILESCC(C)(C)c1ccc(cc1)-c1nc2c(cccc2[nH]1)N1CCN(Cc2ccc3cccnc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: