Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin-releasing hormone receptor
LigandBDBM50256834
Substrate/Competitorn/a
Meas. Tech.ChEMBL_562461
IC50 44±n/a nM
Citation Pelletier JCChengalvala MVCottom JEFeingold IBGreen DMHauze DBHuselton CAJetter JWKopf GSLundquist JTMagolda RLMann CWMehlmann JFRogers JFShanno LKAdams WRTio COWrobel JE Discovery of 6-({4-[2-(4-tert-butylphenyl)-1H-benzimidazol-4-yl]piperazin-1-yl}methyl)quinoxaline (WAY-207024): an orally active antagonist of the gonadotropin releasing hormone receptor (GnRH-R). J Med Chem 52:2148-52 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin-releasing hormone receptor
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R
Type:PROTEIN
Mol. Mass.:37767.60
Organism:Rattus norvegicus
Description:ChEMBL_1335047
Residue:327
Sequence:
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50256834
n/a
NameBDBM50256834
Synonyms:7-((4-(2-(4-tert-butylphenyl)-1H-benzo[d]imidazol-4-yl)piperazin-1-yl)methyl)-1-methylquinoxaline-2,3(1H,4H)-dione | CHEMBL513998
TypeSmall organic molecule
Emp. Form.C31H34N6O2
Mol. Mass.522.6407
SMILESCn1c2cc(CN3CCN(CC3)c3cccc4[nH]c(nc34)-c3ccc(cc3)C(C)(C)C)ccc2[nH]c(=O)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: