Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 Receptor
LigandBDBM50256882
Substrate/Competitorn/a
Meas. Tech.ChEMBL_562478
Ki 850±n/a nM
Citation Pelletier JCChengalvala MVCottom JEFeingold IBGreen DMHauze DBHuselton CAJetter JWKopf GSLundquist JTMagolda RLMann CWMehlmann JFRogers JFShanno LKAdams WRTio COWrobel JE Discovery of 6-({4-[2-(4-tert-butylphenyl)-1H-benzimidazol-4-yl]piperazin-1-yl}methyl)quinoxaline (WAY-207024): an orally active antagonist of the gonadotropin releasing hormone receptor (GnRH-R). J Med Chem 52:2148-52 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 Receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40115.31
Organism:Homo sapiens (Human)
Description:n/a
Residue:359
Sequence:
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50256882
n/a
NameBDBM50256882
Synonyms:6-((4-(2-(4-tert-butylphenyl)-1H-benzo[d]imidazol-4-yl)piperazin-1-yl)methyl)quinoxaline | CHEMBL474991 | WAY-207024
TypeSmall organic molecule
Emp. Form.C30H32N6
Mol. Mass.476.6153
SMILESCC(C)(C)c1ccc(cc1)-c1nc2c(cccc2[nH]1)N1CCN(Cc2ccc3nccnc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: