Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntermediate conductance calcium-activated potassium channel protein 4
LigandBDBM31774
Substrate/Competitorn/a
Meas. Tech.ChEMBL_545457
IC50 70±n/a nM
Citation Pegoraro SLang MDreker TKraus JHamm SMeere CFeurle JTasler SPrütting SKuras ZVisan VGrissmer S Inhibitors of potassium channels KV1.3 and IK-1 as immunosuppressants. Bioorg Med Chem Lett 19:2299-304 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Intermediate conductance calcium-activated potassium channel protein 4
Name:Intermediate conductance calcium-activated potassium channel protein 4
Synonyms:IK1 | IKCa1 | KCa4 | Putative Gardos channel | SK4
Type:PROTEIN
Mol. Mass.:47723.22
Organism:Homo sapiens (Human)
Description:ChEMBL_1361891
Residue:427
Sequence:
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31774
n/a
NameBDBM31774
Synonyms:CHEMBL104 | Canesten | Clotrimazole | Lotrimin | Mycelex | US9138393, Clotrimazole | cid_2812
TypeSmall organic molecule
Emp. Form.C22H17ClN2
Mol. Mass.344.837
SMILESClc1ccccc1C(c1ccccc1)(c1ccccc1)n1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: