Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel
LigandBDBM50278994
Substrate/Competitorn/a
Meas. Tech.ChEMBL_545452
IC50 1500±n/a nM
Citation Pegoraro SLang MDreker TKraus JHamm SMeere CFeurle JTasler SPrütting SKuras ZVisan VGrissmer S Inhibitors of potassium channels KV1.3 and IK-1 as immunosuppressants. Bioorg Med Chem Lett 19:2299-304 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel
Name:Voltage-gated potassium channel
Synonyms:HGK5 | HLK3 | HPCN3 | HuKIII | Potassium voltage-gated channel subfamily A member 3 | Voltage-gated potassium channel subunit Kv1.3
Type:PROTEIN
Mol. Mass.:63835.47
Organism:Homo sapiens (Human)
Description:ChEMBL_1513935
Residue:575
Sequence:
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH
LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50278994
n/a
NameBDBM50278994
Synonyms:CHEMBL498728 | phenanthridine-5,6(6H)-diylbis(furan-2-ylmethanone)
TypeSmall organic molecule
Emp. Form.C23H15NO4
Mol. Mass.369.3695
SMILESO=C(C1N(C(=O)c2ccco2)c2ccccc2-c2ccccc12)c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: