| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 1 |
|---|
| Ligand | BDBM50249265 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_499713 (CHEMBL980648) |
|---|
| IC50 | 7.7±n/a nM |
|---|
| Citation |  Evindar, G; Satz, AL; Bernier, SG; Kavarana, MJ; Doyle, E; Lorusso, J; Taghizadeh, N; Halley, K; Hutchings, A; Kelley, MS; Wright, AD; Saha, AK; Hannig, G; Morgan, BA; Westlin, WF Synthesis and evaluation of arylalkoxy- and biarylalkoxy-phenylamide and phenylimidazoles as potent and selective sphingosine-1-phosphate receptor subtype-1 agonists. Bioorg Med Chem Lett19:2315-9 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 1 |
|---|
| Name: | Sphingosine 1-phosphate receptor 1 |
|---|
| Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42836.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21453 |
|---|
| Residue: | 382 |
|---|
| Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
|---|
| BDBM50249265 |
|---|
| n/a |
|---|
| Name | BDBM50249265 |
|---|
| Synonyms: | (R)-2-amino-2-(4-(4-(2-(biphenyl-4-yl)ethoxy)phenyl)-1H-imidazol-2-yl)propyl dihydrogen phosphate | CHEMBL474418 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H28N3O5P |
|---|
| Mol. Mass. | 493.4914 |
|---|
| SMILES | C[C@](N)(COP(O)(O)=O)c1nc(c[nH]1)-c1ccc(OCCc2ccc(cc2)-c2ccccc2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
