| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM50277632 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_501285 (CHEMBL971471) |
|---|
| Ki | 7323±n/a nM |
|---|
| Citation |  Leblanc, Y; Roy, P; Dufresne, C; Lachance, N; Wang, Z; O'Neill, G; Greig, G; Denis, D; Mathieu, MC; Slipetz, D; Sawyer, N; Tsou, N Discovery of potent and selective DP1 receptor antagonists in the azaindole series. Bioorg Med Chem Lett19:2125-8 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM50277632 |
|---|
| n/a |
|---|
| Name | BDBM50277632 |
|---|
| Synonyms: | (S)-2-(9-(3,4-dichlorophenylthio)-1-isopropyl-7,8-dihydro-6H-pyrido[3,4-b]pyrrolizin-8-yl)acetic acid | CHEMBL484778 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20Cl2N2O2S |
|---|
| Mol. Mass. | 435.367 |
|---|
| SMILES | CC(C)c1nccc2n3CC[C@@H](CC(O)=O)c3c(Sc3ccc(Cl)c(Cl)c3)c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
