Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2C8
LigandBDBM50277674
Substrate/Competitorn/a
Meas. Tech.ChEMBL_501338
IC50 20000±n/a nM
Citation Shen HCDing FXDeng QWilsie LCKrsmanovic MLTaggart AKCarballo-Jane ERen NCai TQWu TJWu KKCheng KChen QWolff MSTong XHolt TGWaters MGHammond MLTata JRColletti SL Discovery of novel tricyclic full agonists for the G-protein-coupled niacin receptor 109A with minimized flushing in rats. J Med Chem 52:2587-602 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2C8
Name:Cytochrome P450 2C8
Synonyms:CYPIIC8 | Cytochrome P450 2C8 (CYP2C8) | P450 IIC2 | P450 MP-12/MP-20 | P450 form 1 | S-mephenytoin 4-hydroxylase
Type:Protein
Mol. Mass.:55839.23
Organism:Homo sapiens (Human)
Description:P10632
Residue:490
Sequence:
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277674
n/a
NameBDBM50277674
Synonyms:2-(3-(6-hydroxy-4H-indeno[2,1-d]isoxazol-3-yl)propanamido)benzoic acid | CHEMBL482980
TypeSmall organic molecule
Emp. Form.C20H16N2O5
Mol. Mass.364.3514
SMILESOC(=O)c1ccccc1NC(=O)CCc1noc-2c1Cc1cc(O)ccc-21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: