| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 4 |
|---|
| Ligand | BDBM50267398 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_563013 (CHEMBL1016197) |
|---|
| IC50 | 10±n/a nM |
|---|
| Citation |  Tsou, HR; Liu, X; Birnberg, G; Kaplan, J; Otteng, M; Tran, T; Kutterer, K; Tang, Z; Suayan, R; Zask, A; Ravi, M; Bretz, A; Grillo, M; McGinnis, JP; Rabindran, SK; Ayral-Kaloustian, S; Mansour, TS Discovery of 4-(benzylaminomethylene)isoquinoline-1,3-(2H,4H)-diones and 4-[(pyridylmethyl)aminomethylene]isoquinoline-1,3-(2H,4H)-diones as potent and selective inhibitors of the cyclin-dependent kinase 4. J Med Chem52:2289-310 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 4 |
|---|
| Name: | Cyclin-dependent kinase 4 |
|---|
| Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33731.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11802 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
|---|
| BDBM50267398 |
|---|
| n/a |
|---|
| Name | BDBM50267398 |
|---|
| Synonyms: | 4-[(3-Hydroxy-4-pyridin-3-yl-benzylamino)-methylene]-6-iodo-4H-isoquinoline-1,3-dione | CHEMBL452447 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H16IN3O3 |
|---|
| Mol. Mass. | 497.2852 |
|---|
| SMILES | Oc1cc(CNC=C2C(=O)NC(=O)c3ccc(I)cc23)ccc1-c1cccnc1 |w:6.5| |
|---|
| Structure | 
|
|---|
Search and Browse
