Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50267772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_563053
EC50 1.1±n/a nM
Citation Vachal PFletcher JMFong TMHuang CCLao JXiao JCShen CPStrack AMShearman LStribling SChen RZFrassetto ATong XWang JBall RGTsou NNHickey GJThompson DFFaidley TDNicolich SAchanfuo-Yeboah JHora DFHale JJHagmann WK 1-Sulfonyl-4-acylpiperazines as selective cannabinoid-1 receptor (CB1R) inverse agonists for the treatment of obesity. J Med Chem 52:2550-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:CANN6 | CANNABINOID CB1 | CB-R | CB1 | CNR | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor | Cannabinoid receptor 1 (CB1) | Cannabinoid receptor 1 (brain)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52868.96
Organism:Homo sapiens (Human)
Description:P21554
Residue:472
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50267772
n/a
NameBDBM50267772
Synonyms:CHEMBL522930 | cyclohexyl(4-(3,5-dimethylphenylsulfonyl)piperazin-1-yl)methanone
TypeSmall organic molecule
Emp. Form.C19H28N2O3S
Mol. Mass.364.502
SMILESCc1cc(C)cc(c1)S(=O)(=O)N1CCN(CC1)C(=O)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: