Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50259223
Substrate/Competitorn/a
Meas. Tech.ChEMBL_500189
IC50 1800±n/a nM
Citation Debenham JSMadsen-Duggan CBWang JTong XLao JFong TMSchaeffer MTXiao JCHuang CCShen CPSloan Stribling DShearman LPStrack AMEuan Macintyre DHale JJWalsh TF Pyridopyrimidine based cannabinoid-1 receptor inverse agonists: Synthesis and biological evaluation. Bioorg Med Chem Lett 19:2591-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259223
n/a
NameBDBM50259223
Synonyms:2-tert-butyl-7-(2-chlorophenyl)-6-(4-chlorophenyl)-4-(piperazin-1-yl)pyrido[2,3-d]pyrimidine | CHEMBL466685
TypeSmall organic molecule
Emp. Form.C27H27Cl2N5
Mol. Mass.492.443
SMILESCC(C)(C)c1nc(N2CCNCC2)c2cc(-c3ccc(Cl)cc3)c(nc2n1)-c1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: