Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine Binding protein
LigandBDBM10759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_563557
Ki 3162.28±n/a nM
Citation Ulens CAkdemir AJongejan Avan Elk RBertrand SPerrakis ALeurs RSmit ABSixma TKBertrand Dde Esch IJ Use of acetylcholine binding protein in the search for novel alpha7 nicotinic receptor ligands. In silico docking, pharmacological screening, and X-ray analysis. J Med Chem 52:2372-83 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine Binding protein
Name:Acetylcholine Binding protein
Synonyms:ACh-binding protein | Acetylcholine-binding protein | Acetylcholine-binding protein (AchBP) | Acetylcholine-binding protein (Ls-AchBP) | AchBP
Type:n/a
Mol. Mass.:26055.52
Organism:Lymnaea stagnalis
Description:Soluble acetylcholine receptor
Residue:229
Sequence:
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10759
n/a
NameBDBM10759
Synonyms:2-acetoxyethyl(trimethyl)ammonium;bromide | 2-acetoxyethyl(trimethyl)ammonium;perchlorate | CHEMBL667 | [2-(acetyloxy)ethyl]trimethylazanium | acetylcholine | acetylcholine chloride | cid_6060
TypeSmall Organic Molecule
Emp. Form.C7H16NO2
Mol. Mass.146.2069
SMILESCC(=O)OCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: