Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50259142 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_500504 (CHEMBL1009681) |
---|
Ki | 3347±n/a nM |
---|
Citation | Yang, SW; Ho, G; Tulshian, D; Greenlee, WJ; Tan, Z; Zhang, H; Smith-Torhan, A; Fawzi, A; Anthes, J; Lu, S; Varty, G; Fernandez, X; McLeod, RL; Hey, J Identification of 3-substituted N-benzhydryl-nortropane analogs as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett19:2482-6 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50259142 |
---|
n/a |
---|
Name | BDBM50259142 |
Synonyms: | CHEMBL3084529 | endo-8-(bis(2-chlorophenyl)methyl)-3-(5-fluoropyridin-2-yl)-8-azabicyclo[3.2.1]octane-3-carboxamide |
Type | Small organic molecule |
Emp. Form. | C26H24Cl2FN3O |
Mol. Mass. | 484.393 |
SMILES | [H][C@]12CC[C@]([H])(C[C@](C1)(C(N)=O)c1ccc(F)cn1)N2C(c1ccccc1Cl)c1ccccc1Cl |r,TLB:9:7:19:3.2| |
Structure |
|