Reaction Details |
| Report a problem with these data |
Target | Nociceptin receptor |
---|
Ligand | BDBM50259581 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_500498 (CHEMBL1009675) |
---|
Ki | 46.0±n/a nM |
---|
Citation | Yang, SW; Ho, G; Tulshian, D; Greenlee, WJ; Tan, Z; Zhang, H; Smith-Torhan, A; Fawzi, A; Anthes, J; Lu, S; Varty, G; Fernandez, X; McLeod, RL; Hey, J Identification of 3-substituted N-benzhydryl-nortropane analogs as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett19:2482-6 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nociceptin receptor |
---|
Name: | Nociceptin receptor |
Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40702.87 |
Organism: | Homo sapiens (Human) |
Description: | P41146 |
Residue: | 370 |
Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
BDBM50259581 |
---|
n/a |
---|
Name | BDBM50259581 |
Synonyms: | CHEMBL3084561 | endo-8-(bis(2-chlorophenyl)methyl)-3-(6-bromopyridin-3-yl)-8-azabicyclo[3.2.1]octane-3-carboxamide |
Type | Small organic molecule |
Emp. Form. | C26H24BrCl2N3O |
Mol. Mass. | 545.298 |
SMILES | [H][C@]12CC[C@]([H])(C[C@](C1)(C(N)=O)c1ccc(Br)nc1)N2C(c1ccccc1Cl)c1ccccc1Cl |r,TLB:9:7:19:3.2| |
Structure |
|