Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 3 |
---|
Ligand | BDBM50267523 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_563644 (CHEMBL963379) |
---|
IC50 | 25100±n/a nM |
---|
Citation | Gaisina, IN; Gallier, F; Ougolkov, AV; Kim, KH; Kurome, T; Guo, S; Holzle, D; Luchini, DN; Blond, SY; Billadeau, DD; Kozikowski, AP From a natural product lead to the identification of potent and selective benzofuran-3-yl-(indol-3-yl)maleimides as glycogen synthase kinase 3beta inhibitors that suppress proliferation and survival of pancreatic cancer cells. J Med Chem52:1853-63 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 3 |
---|
Name: | Cyclin-dependent kinase 3 |
Synonyms: | CDK3 | CDK3/Cyclin E | CDK3_HUMAN | CDKN3 | Cyclin-dependent kinase 3 | Cyclin-dependent kinase 3 (CDK3) |
Type: | Enzyme |
Mol. Mass.: | 35053.88 |
Organism: | Homo sapiens (Human) |
Description: | Q00526 |
Residue: | 305 |
Sequence: | MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH
|
|
|
BDBM50267523 |
---|
n/a |
---|
Name | BDBM50267523 |
Synonyms: | 3-(6-Chloro-5-fluoro-1-methyl-1H-indol-3-yl)-4-(6-hydroxymethylbenzofuran-3-yl)pyrrole-2,5-dione | CHEMBL522590 |
Type | Small organic molecule |
Emp. Form. | C22H14ClFN2O4 |
Mol. Mass. | 424.809 |
SMILES | Cn1cc(C2=C(C(=O)NC2=O)c2coc3cc(CO)ccc23)c2cc(F)c(Cl)cc12 |t:4| |
Structure |
|