| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50258880 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_500680 (CHEMBL966896) |
|---|
| Ki | 2854±n/a nM |
|---|
| Citation |  Ho, GD; Anthes, J; Bercovici, A; Caldwell, JP; Cheng, KC; Cui, X; Fawzi, A; Fernandez, X; Greenlee, WJ; Hey, J; Korfmacher, W; Lu, SX; McLeod, RL; Ng, F; Torhan, AS; Tan, Z; Tulshian, D; Varty, GB; Xu, X; Zhang, H The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett19:2519-23 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50258880 |
|---|
| n/a |
|---|
| Name | BDBM50258880 |
|---|
| Synonyms: | 8-(dio-tolylmethyl)-3-phenyl-8-azabicyclo[3.2.1]octan-3-ol | CHEMBL513136 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H31NO |
|---|
| Mol. Mass. | 397.5518 |
|---|
| SMILES | Cc1ccccc1C(N1C2CCC1CC(O)(C2)c1ccccc1)c1ccccc1C |THB:15:14:8:10.11| |
|---|
| Structure | 
|
|---|
Search and Browse
