Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase II alpha
LigandBDBM11318
Substrate/Competitorn/a
Meas. Tech.ChEMBL_500824
IC50 2000±n/a nM
Citation Sekiguchi YNakaniwa TKinoshita TNakanishi IKitaura KHirasawa ATsujimoto GTada T Structural insight into human CK2alpha in complex with the potent inhibitor ellagic acid. Bioorg Med Chem Lett 19:2920-3 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase II alpha
Name:Casein kinase II alpha
Synonyms:CK II | CK2 | CK2- alpha | CK2A1 | CSNK2A1 | Casein kinase II (CK2) | Casein kinase II alpha/beta | Casein kinase II subunit alpha | Casein kinase II subunit alpha (CK2 alpha) | Casein kinase II subunit alpha (CK2A1) | Casein kinase II subunit alpha (CK2a I174A) | Casein kinase II subunit alpha (CK2a V66A) | Casein kinase II subunit alpha (CK2a dm V66I174AA) | Casein kinase II subunit alpha (CK2a) | Casein kinase II subunit alpha (CK2α)
Type:Enzyme
Mol. Mass.:45151.12
Organism:Homo sapiens (Human)
Description:P68400
Residue:391
Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11318
n/a
NameBDBM11318
Synonyms:1,3,8-trihydroxy-6-methyl-9,10-dihydroanthracene-9,10-dione | 1,3,8-trihydroxy-6-methylanthra-9,10-quinone | CHEMBL289277 | Emodin
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESCc1cc(O)c2C(=O)c3c(O)cc(O)cc3C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: