Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-1
LigandBDBM26697
Substrate/Competitorn/a
Meas. Tech.ChEMBL_500013
Ki 22±n/a nM
Citation Grey RPierce ACBemis GWJacobs MDMoody CSJajoo RMohal NGreen J Structure-based design of 3-aryl-6-amino-triazolo[4,3-b]pyridazine inhibitors of Pim-1 kinase. Bioorg Med Chem Lett 19:3019-22 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-1
Name:Serine/threonine-protein kinase pim-1
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:35681.82
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26697
n/a
NameBDBM26697
Synonyms:7-chloro-9-ethyl-6-fluoro-1H,3H,4H,9H-quinolino[2,3-c][1,2]oxazole-3,4-dione | CHEMBL468280 | Isoxazoloquinolinedione, 1
TypeSmall organic molecule
Emp. Form.C12H8ClFN2O3
Mol. Mass.282.655
SMILESCCn1c2noc(=O)c2c(O)c2cc(F)c(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: