Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PIM
LigandBDBM26668
Substrate/Competitorn/a
Meas. Tech.ChEMBL_500013
Ki 11±n/a nM
Citation Grey RPierce ACBemis GWJacobs MDMoody CSJajoo RMohal NGreen J Structure-based design of 3-aryl-6-amino-triazolo[4,3-b]pyridazine inhibitors of Pim-1 kinase. Bioorg Med Chem Lett 19:3019-22 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase PIM
Name:Serine/threonine-protein kinase PIM
Synonyms:2.7.11.1 | PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:45417.87
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26668
n/a
NameBDBM26668
Synonyms:CHEMBL494360 | N-cyclohexyl-3-[3-(trifluoromethyl)phenyl]-[1,2,4]triazolo[3,4-a]pyridin-6-amine | triazolopyridazine compound, 1
TypeSmall organic molecule
Emp. Form.C18H18F3N5
Mol. Mass.361.3642
SMILESFC(F)(F)c1cccc(c1)-c1nnc2ccc(NC3CCCCC3)nn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: