Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase (mtCA 1)
LigandBDBM50258715
Substrate/Competitorn/a
Meas. Tech.ChEMBL_519733
Ki 110±n/a nM
Citation Güzel OMaresca AScozzafava ASalman ABalaban ATSupuran CT Discovery of low nanomolar and subnanomolar inhibitors of the mycobacterial beta-carbonic anhydrases Rv1284 and Rv3273. J Med Chem 52:4063-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase (mtCA 1)
Name:Carbonic Anhydrase (mtCA 1)
Synonyms:β-Carbonic anhydrase 1 (CA 1) | Uncharacterized protein Rv1284/MT1322
Type:Enzyme
Mol. Mass.:18186.06
Organism:Mycobacterium tuberculosis
Description:The recombinant GST-mtCA1 construct was cloned, expressed, and further purified from E. coli. The purified protein was used in inhibition assays.
Residue:163
Sequence:
MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50258715
n/a
NameBDBM50258715
Synonyms:1-({[5-(Aminosulfonyl)-3-(3-bromophenyl)-1H-indol-2-yl]carbonyl}amino)-2,4,6 trimethylpyridinium perchlorate | 2,4,6-trimethyl-1-(5-sulfamoyl-3-m-tolyl-1H-indole-2-carboxamido)pyridinium perchlorate | CHEMBL468945
TypeSmall organic molecule
Emp. Form.C24H25N4O3S
Mol. Mass.449.545
SMILESCc1cccc(c1)-c1c([nH]c2ccc(cc12)S(N)(=O)=O)C(=O)N[n+]1c(C)cc(C)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: