| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 1 |
|---|
| Ligand | BDBM50280290 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_99654 |
|---|
| Ki | 25±n/a nM |
|---|
| Citation |  Sofia, MJ; SaussyJr., DL; Jackson, WT; Marder, P; Silbaugh, SA; Froelich, LL; Cockerham, SL; Stengel, PW Ortho-alkoxyphenol leukotriene B4 receptor antagonists: effect of a chroman carboxylic acid. Bioorg Med Chem Lett2:1675-1680 (1992) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene B4 receptor 1 |
|---|
| Name: | Leukotriene B4 receptor 1 |
|---|
| Synonyms: | BLT | BLT1 | BLTR | CMKRL1 | Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | GPR16 | LT4R1_HUMAN | LTB4-R 1 | LTB4R | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2RY7 | P2Y purinoceptor 7 | P2Y7 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37582.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15722 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
|
|
|
|---|
| BDBM50280290 |
|---|
| n/a |
|---|
| Name | BDBM50280290 |
|---|
| Synonyms: | 4-ethyl-2-methoxy-5-[6-methyl-6-(2H-1,2,3,4-tetraazol-5-yl)heptyloxy]phenol; with sodium ion | CHEMBL46820 | sodium 4-ethyl-2-methoxy-5-[6-methyl-6-(2H-1,2,3,4-tetraazol-5-yl)heptyloxy]phenol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H27N4O3 |
|---|
| Mol. Mass. | 347.4325 |
|---|
| SMILES | CCc1cc(OC)c(O)cc1OCCCCCC(C)(C)c1nn[n-]n1 |
|---|
| Structure | 
|
|---|
Search and Browse
