new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50280331
Substrate/Competitorn/a
Meas. Tech.ChEBML_36160
IC50 540±n/a nM
Citation Murray WVLalan PGill AAddo MFLewis JMLee DKRampulla RWachter MPHsi JDUnderwood DC Substituted piperidin-2-one biphenyltetrazoles as angiotensin II antagonists Bioorg Med Chem Lett 2:1775-1779 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41107.81
Organism:Bos taurus
Description:ChEMBL_36779
Residue:359
Sequence:
MILNSSTEDGIKRIQDDCPKAGRHNYIFIMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC
AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKTLKKAYEIQKNKPRKDDIFK
IILAIVLFFFFSWVPHQIFTFMDVLIQLGLIRDCKIEDIVDTAMPITICLAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSENGNSSTKKPAPCIEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280331
n/a
NameBDBM50280331
Synonyms:CHEMBL49192 | [9-Oxo-8-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-8-aza-spiro[4.5]dec-(7E)-ylidene]-acetic acid ethyl ester
TypeSmall organic molecule
Emp. Form.C27H29N5O3
Mol. Mass.471.5509
SMILESCCOC(=O)\C=C1/CC2(CCCC2)CC(=O)N1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: