Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50280338 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_96619 (CHEMBL708177) |
---|
Ki | 17500±n/a nM |
---|
Citation | Groutas, WC; Brubaker, MJ; Venkataraman, R; Epp, JB; Houser-Archield, N; Chong, LS; McClenahan, JJ Potential mechanism-based inhibitors of proteolytic enzymes Bioorg Med Chem Lett2:175-180 (1992) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50280338 |
---|
n/a |
---|
Name | BDBM50280338 |
Synonyms: | 2-((S)-3-Amino-5-methyl-2-oxo-hexyl)-isoindole-1,3-dione; hydrochloride | CHEMBL542119 |
Type | Small organic molecule |
Emp. Form. | C15H18N2O3 |
Mol. Mass. | 274.315 |
SMILES | CC(C)C[C@H](N)C(=O)CN1C(=O)c2ccccc2C1=O |r| |
Structure |
|