Reaction Details |
| Report a problem with these data |
Target | Chymotrypsin-like elastase family member 2A |
---|
Ligand | BDBM50281092 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_194721 (CHEMBL807702) |
---|
IC50 | 11000±n/a nM |
---|
Citation | Adonias, M; Anayaba, J; Cámara, J; Canet, E; Gateau-Olesker, A; Gero, SD; Grande, M; Hernando, JI Enantioselective synthesis and antielastase activity of 1,3,4-trisubstituted and 3,4-disubstituted β-lactam antibiotics Bioorg Med Chem Lett3:2547-2552 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsin-like elastase family member 2A |
---|
Name: | Chymotrypsin-like elastase family member 2A |
Synonyms: | CEL2A_RAT | Cela2a | Ela2 | Ela2a | Elastase 2A | Elastase-2 | Elastase-2A |
Type: | PROTEIN |
Mol. Mass.: | 28894.94 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_194721 |
Residue: | 271 |
Sequence: | MIRTLLLSALVAGALSCGYPTYEVQHDVSRVVGGQEASPNSWPWQVSLQYLSSGKWHHTC
GGSLVANNWVLTAAHCISNSRTYRVLLGRHSLSTSESGSLAVQVSKLVVHEKWNAQKLSN
GNDIALVKLASPVALTSKIQTACLPPAGTILPNNYPCYVTGWGRLQTNGATPDVLQQGRL
LVVDYATCSSASWWGSSVKTNMVCAGGDGVTSSCNGDSGGPLNCQASNGQWQVHGIVSFG
STLGCNYPRKPSVFTRVSNYIDWINSVIAKN
|
|
|
BDBM50281092 |
---|
n/a |
---|
Name | BDBM50281092 |
Synonyms: | (3S,4S)-1,4-Diacetyl-3-methoxy-azetidin-2-one | CHEMBL310133 |
Type | Small organic molecule |
Emp. Form. | C8H11NO4 |
Mol. Mass. | 185.1772 |
SMILES | CO[C@H]1[C@H](N(C(C)=O)C1=O)C(C)=O |
Structure |
|