new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMast cell carboxypeptidase A
LigandBDBM50281176
Substrate/Competitorn/a
Meas. Tech.ChEBML_45634
Ki 7.8±n/a nM
Citation Kim DHKim YJ Synthesis and inhibitory activity of optically active 2-benzyl-3-mercaptopropanoic acid against carboxypeptidase A Bioorg Med Chem Lett 3:2681-2684 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Mast cell carboxypeptidase A
Name:Mast cell carboxypeptidase A
Synonyms:Carboxypeptidase A3 | MC-CPA
Type:PROTEIN
Mol. Mass.:48684.88
Organism:Homo sapiens (Human)
Description:ChEMBL_45634
Residue:417
Sequence:
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281176
n/a
NameBDBM50281176
Synonyms:(S)-2-Mercaptomethyl-3-phenyl-propionic acid | 2-THIOMETHYL-3-PHENYLPROPANOIC ACID | CHEMBL90403
TypeSmall organic molecule
Emp. Form.C10H12O2S
Mol. Mass.196.266
SMILESOC(=O)[C@@H](CS)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: