| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50281466 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79957 |
|---|
| Ki | 1±n/a nM |
|---|
| Citation |  Schirlin, D; Baltzer, S; Dorsselaer, VV; Weber, F; Weill, C; Altenburger, JM; Neises, B; Flynn, G; Rémy, JM; Tarnus, C Short and unexpectedly potent difluorostatone type inhibitors of HIV-1 protease Bioorg Med Chem Lett3:253-258 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50281466 |
|---|
| n/a |
|---|
| Name | BDBM50281466 |
|---|
| Synonyms: | CHEMBL86651 | [1-(1-Benzyl-3-benzylcarbamoyl-3,3-difluoro-2-oxo-propylcarbamoyl)-2-methyl-propyl]-carbamic acid benzyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H33F2N3O5 |
|---|
| Mol. Mass. | 565.6076 |
|---|
| SMILES | CC(C)C(NC(=O)OCc1ccccc1)C(=O)NC(Cc1ccccc1)C(=O)C(F)(F)C(=O)NCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
