| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50281498 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_201269 |
|---|
| Ki | 2.72±n/a nM |
|---|
| Citation |  Wustrow, DJ; Wise, LD; Pugsley, TA; Meltzer, LT; Heffner, TG 4-Aryltetrahydropyridines as selective σ ligands Bioorg Med Chem Lett3:277-280 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50281498 |
|---|
| n/a |
|---|
| Name | BDBM50281498 |
|---|
| Synonyms: | 4-[4-(4-Phenyl-3,6-dihydro-2H-pyridin-1-yl)-butyl]-pyridine | CHEMBL96777 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24N2 |
|---|
| Mol. Mass. | 292.418 |
|---|
| SMILES | C(CCc1ccncc1)CN1CCC(=CC1)c1ccccc1 |c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
