new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50281519
Substrate/Competitorn/a
Meas. Tech.ChEBML_36774
IC50 140±n/a nM
Citation Murray WVLalan PGill AAddo MFLewis JMLee DKWachter MPRampulla RUnderwood DC Substituted pyrrolidin-2-one biphenyltetrazoles as angiotensin II antagonists Bioorg Med Chem Lett 3:369-374 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41107.81
Organism:Bos taurus
Description:ChEMBL_36779
Residue:359
Sequence:
MILNSSTEDGIKRIQDDCPKAGRHNYIFIMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC
AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKTLKKAYEIQKNKPRKDDIFK
IILAIVLFFFFSWVPHQIFTFMDVLIQLGLIRDCKIEDIVDTAMPITICLAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSENGNSSTKKPAPCIEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281519
n/a
NameBDBM50281519
Synonyms:CHEMBL124449 | [3-Oxo-2-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-2-aza-spiro[4.5]dec-(1Z)-ylidene]-acetic acid ethyl ester
TypeSmall organic molecule
Emp. Form.C27H29N5O3
Mol. Mass.471.5509
SMILESCCOC(=O)\C=C1/N(Cc2ccc(cc2)-c2ccccc2-c2nnn[nH]2)C(=O)CC11CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: