Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50281566 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_162612 |
---|
IC50 | 11±n/a nM |
---|
Citation | Holmes, DS; Clemens, IR; Cobley, KN; Humber, DC; Kitchin, J; Orr, DC; Patel, B; Paternoster, IL; Storer, R Novel dimeric penicillin derived inhibitors of HIV-1 proteinase: interaction with the catalytic aspartates Bioorg Med Chem Lett3:503-508 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50281566 |
---|
n/a |
---|
Name | BDBM50281566 |
Synonyms: | 1N-propyl-2-benzylcarboxamido-2-[4-[2-[2-benzylcarboxamido(ethylcarbamoyl)methyl-5,5-dimethyl-(2R,4S)-1,3-thiazolan-4-yl(methyl)carboxamido]ethyl(methyl)carbamoyl]-5,5-dimethyl-(2R,4S)-1,3-thiazolan-2-yl]acetamide | CHEMBL150003 |
Type | Small organic molecule |
Emp. Form. | C41H60N8O6S2 |
Mol. Mass. | 825.095 |
SMILES | CCCNC(=O)[C@@H](NC(=O)Cc1ccccc1)[C@@H]1N[C@@H](C(=O)N(C)CCN(C)C(=O)[C@@H]2N[C@H](SC2(C)C)[C@H](NC(=O)Cc2ccccc2)C(=O)NCC)C(C)(C)S1 |
Structure |
|