| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM636 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_162612 |
|---|
| IC50 | 5±n/a nM |
|---|
| Citation |  Holmes, DS; Clemens, IR; Cobley, KN; Humber, DC; Kitchin, J; Orr, DC; Patel, B; Paternoster, IL; Storer, R Novel dimeric penicillin derived inhibitors of HIV-1 proteinase: interaction with the catalytic aspartates Bioorg Med Chem Lett3:503-508 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM636 |
|---|
| n/a |
|---|
| Name | BDBM636 |
|---|
| Synonyms: | (2R,4S)-2-[(R)-(benzylcarbamoyl)(1-phenylacetamido)methyl]-N-(3-{[(2R,4S)-2-[(R)-(benzylcarbamoyl)(1-phenylacetamido)methyl]-5,5-dimethyl-1,3-thiazolidin-4-yl]formamido}-2-hydroxypropyl)-5,5-dimethyl-1,3-thiazolidine-4-carboxamide | CHEMBL317882 | Penicillin Et(NH)2 Sym dimer | penicillin deriv. 49 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C49H60N8O7S2 |
|---|
| Mol. Mass. | 937.18 |
|---|
| SMILES | [H][C@]1(N[C@@H](C(=O)NCC(O)CNC(=O)[C@@H]2N[C@]([H])(SC2(C)C)[C@H](NC(=O)Cc2ccccc2)C(=O)NCc2ccccc2)C(C)(C)S1)[C@H](NC(=O)Cc1ccccc1)C(=O)NCc1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
