BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin G
LigandBDBM50281589
Substrate/Competitorn/a
Meas. Tech.ChEBML_45365
Ki 2200±n/a nM
Citation Angelastro MRBey PMehdi SJanusz MJPeet NP Janus compounds: dual inhibitors of proteinases Bioorg Med Chem Lett 3:525-530 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin G
Name:Cathepsin G
Synonyms:CG
Type:PROTEIN
Mol. Mass.:28860.08
Organism:Homo sapiens (Human)
Description:ChEMBL_1469016
Residue:255
Sequence:
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281589
n/a
NameBDBM50281589
Synonyms:5N-(1-benzyl-3,3,3-trifluoro-2-oxopropyl)-1-[3-methyl-2-{4-[2-methyl-1-[5-(3,3,4,4,4-pentafluoro-1-isopropyl-2-oxobutylcarbamoyl)-(5S)-dihydro-1H-1-pyrrolylcarbonyl]-(1S)-propylcarbamoyl]phenylcarboxamido}-(2R)-butanoyl]-(5R)-dihydro-1 | CHEMBL422675
TypeSmall organic molecule
Emp. Form.C45H54F8N6O8
Mol. Mass.958.9329
SMILESCC(C)[C@@H](NC(=O)c1ccc(cc1)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)NC(C(C)C)C(=O)C(F)(F)C(F)(F)F)C(=O)N1CCC[C@@H]1C(=O)NC(Cc1ccccc1)C(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: