new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeutral Endopeptidase (NEP)
LigandBDBM50281657
Substrate/Competitorn/a
Meas. Tech.ChEBML_144313
IC50 38±n/a nM
Citation James KPalmer MJ Gem-cycloalkyl substituted thiol inhibitors of neutral endopeptidase 24.11. Synthesis via nucleophilic opening of 2,2-spiro-β-lactones Bioorg Med Chem Lett 3:825-830 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Neutral Endopeptidase (NEP)
Name:Neprilysin
Synonyms:Neutral endopeptidase 24.11
Type:Protein
Mol. Mass.:85789.59
Organism:Rattus norvegicus (Rat)
Description:P07861
Residue:750
Sequence:
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDASAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLTLLPDIYGWPVASQNWEQTYGT
SWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEQRLPIDENQLSLEMNKVMELEKEIANATTKPEDRNDPMLLY
NKMTLAKLQNNFSLEINGKPFSWSNFTNEIMSTVNINIQNEEEVVVYAPEYLTKLKPILT
KYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNENKLNNEYLELNYKEEEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSARQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKDQSQCMVYQYGNFTWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFADAFHCRKNSYMNPERKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281657
n/a
NameBDBM50281657
Synonyms:CHEMBL434492 | Candoxatrilat | candoxatrilate | cis-4-[({1-[(2S)-2-carboxy-3-(2-methoxyethoxy)propyl]cyclopentyl}carbonyl)amino]cyclohexanecarboxylic acid
TypeSmall organic molecule
Emp. Form.C20H33NO7
Mol. Mass.399.4785
SMILESCOCCOC[C@H](CC1(CCCC1)C(=O)N[C@H]1CC[C@H](CC1)C(O)=O)C(O)=O |wU:19.23,16.16,wD:6.6,(3.37,-.79,;4.72,-1.56,;4.72,-3.1,;6.05,-3.87,;6.05,-5.41,;7.38,-6.18,;7.38,-7.71,;8.48,-8.8,;9.96,-8.4,;11.29,-7.61,;10.97,-6.11,;9.43,-5.96,;8.82,-7.37,;11.02,-9.52,;11.02,-11.06,;12.35,-8.75,;13.68,-9.52,;15.01,-8.73,;16.34,-9.5,;16.34,-11.04,;15,-11.81,;13.68,-11.04,;17.67,-11.83,;19,-11.07,;17.67,-13.37,;6.05,-8.49,;4.72,-7.71,;6.05,-10.03,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: