new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 2
LigandBDBM50281775
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144147
IC50 5±n/a nM
Citation Beck-Sickinger AGHoffmann EGaida WGrouzmann EDürr HJung G Novel Y2-selective, reduced-size agonists of neuropeptide Y Bioorg Med Chem Lett 3:937-942 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 2
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | NPY-Y2 receptor | NPY2-R | NPY2R | Neuropeptide Y receptor type 2 | Y2 receptor | neuropeptide Y receptor Y2
Type:Enzyme Catalytic Domain
Mol. Mass.:42734.65
Organism:Homo sapiens (Human)
Description:NPY-Y2 NPY2R HUMAN::P49146
Residue:381
Sequence:
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281775
n/a
NameBDBM50281775
Synonyms:Ac-RHYINL-(Cha)-TRQRY | CHEMBL414482
TypeSmall organic molecule
Emp. Form.C77H121N25O19
Mol. Mass.1700.9407
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CCCNC(N)=N)NC(C)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C1CCCCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: